PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla009628
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family Dof
Protein Properties Length: 242aa    MW: 26878.8 Da    PI: 9.4943
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla009628genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.41.8e-392381361
     zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
               +++lkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+ 
  Cla009628 23 SATLKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRL 81
               5689****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-272180IPR003851Zinc finger, Dof-type
PfamPF027016.2E-342580IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5252680IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102864IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MASTSRIMDK PRQEQQQLQQ PPSATLKCPR CDSSNTKFCY YNNYSLSQPR HFCKACKRYW  60
TRGGTLRNVP VGGGCRKNKR LKTSSSSVSA TSTSTPSQNP RLHNSINSST TPNIISSNHI  120
NSPMFFGLDP IGSGGLGFSS SGLLSHFHDL HQQPFNSSQF HHPAISFDRN SHVLGNFEPS  180
LMTPMKEIKI EGLNRLYQNQ SEQIDLSNFS DPSSVYWNSG TTATDNWHDP TNNNGSSIAS  240
LF
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818751e-81LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132621e-81LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008439843.11e-121PREDICTED: dof zinc finger protein DOF1.7-like
SwissprotQ84TE92e-40DOF53_ARATH; Dof zinc finger protein DOF5.3
TrEMBLA0A0A0KI371e-114A0A0A0KI37_CUCSA; Uncharacterized protein
STRINGVIT_10s0003g00040.t012e-48(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.14e-35TARGET OF MONOPTEROS 6